DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and Rab30

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster


Alignment Length:208 Identity:85/208 - (40%)
Similarity:124/208 - (59%) Gaps:14/208 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQER 69
            :..|||::::|::||||:.|:.||:...|......||||||.|:||::||.::||||||||||||
  Fly     4 YKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAGQER 68

  Fly    70 FRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCD-VVKKVLVGNKNDDPDRKVVITE 133
            ||:||.:|||..|.:|:|||::...:|..:..||.|||...: .|.|:|||||.|..||::. |:
  Fly    69 FRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTDRDDREIP-TQ 132

  Fly   134 DAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTLHLKPNPKGSKGG- 197
            ..:.||||.|:...|||||:..|||.:|..|..:::. :.|:............:...:||..| 
  Fly   133 IGEEFAKQHDMYFLETSAKEAENVERLFYEIAAELIG-QARSKDGSSSAAAAAAQRQSEGSSIGL 196

  Fly   198 ----------KCC 200
                      .||
  Fly   197 GSFSAKAAQSNCC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 85/208 (41%)
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 79/164 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.