DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and RAB43

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001191812.1 Gene:RAB43 / 339122 HGNCID:19983 Length:212 Species:Homo sapiens


Alignment Length:200 Identity:87/200 - (43%)
Similarity:127/200 - (63%) Gaps:8/200 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQER 69
            :|.||||:::||:.|||:.::.||....||....:||||||.::|::|:|.||||||||||||||
Human    15 YDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQER 79

  Fly    70 FRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQN--NCDVVKKVLVGNKNDDPDRKVVIT 132
            |||||.:|||..:|.|:.||:|...||.:|..|:|:::.  ..::| ::|:|||:|..:.:.|..
Human    80 FRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIV-QLLIGNKSDLSELREVSL 143

  Fly   133 EDAQRFAKQMDIE-LFETSAKDNINVENMFLSI-TRQVLDHKLRTSPNEQQKDTLHLKPNPKGSK 195
            .:||..|:..||. ..||||||:.|||..||.: |..::.|   ..|...:|...|::.|.|...
Human   144 AEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRH---GGPLFSEKSPDHIQLNSKDIG 205

  Fly   196 GGKCC 200
            .|..|
Human   206 EGWGC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 86/199 (43%)
RAB43NP_001191812.1 Rab19 16..180 CDD:133267 79/164 (48%)
Effector region. /evidence=ECO:0000250 47..55 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.