DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and Rab21

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:208 Identity:72/208 - (34%)
Similarity:123/208 - (59%) Gaps:17/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIE-GMRVKLQIWDTAGQERFRT 72
            ||.:::|:..|||:||::|:.:|.|:..:::|:...|..|.:.:| |.|.:|.||||||||||..
  Fly    14 FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHA 78

  Fly    73 ITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEI-QNNCDVVKKVLVGNKNDDPDRKVVITEDAQ 136
            :...||||:.|.::|||:|:.:||..|:.|:.|: |.....:..::||||.|..:::.|..::|.
  Fly    79 LGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHDEAL 143

  Fly   137 RFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNE-----QQKDTLHLK-------P 189
            ::|:.:..:..|||||:|..|..:|..:|:.:|:...:..|:.     |..||.:|.       |
  Fly   144 QYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQRQPDASPLRLQNPDTDNLNNSDDSEAP 208

  Fly   190 NPKGSKGGK--CC 200
            :| |...|:  ||
  Fly   209 DP-GDPAGQRSCC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 72/208 (35%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 60/161 (37%)
Ras 15..177 CDD:278499 59/161 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454543
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.