DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and Rab9Fb

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_727472.1 Gene:Rab9Fb / 32029 FlyBaseID:FBgn0052670 Length:214 Species:Drosophila melanogaster


Alignment Length:211 Identity:86/211 - (40%)
Similarity:130/211 - (61%) Gaps:15/211 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQER 69
            :|:|||:|::||.|||||.||:||||:.|:..::.|:|:||::|.|::.|..|.||||||||.||
  Fly     4 YDYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDER 68

  Fly    70 FRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQN-NCDVVKKVLVGNKNDDPDRKVVITE 133
            |:::..:||||.||:::|||:|:.:||.|:..||:||:. :.:.|..:|||||.||.|.:.|..|
  Fly    69 FKSLLPSYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLDNRQVRME 133

  Fly   134 DAQRFAKQMDIELFETSAKDNINVENMF--LSI---TRQVLDHKLRTSPNEQQKDT--------- 184
            ....:|....:..:|.|||...||.::|  ||:   .|.|:....|.|..::.:||         
  Fly   134 QGFNYANHRALGFYEVSAKSGANVNDVFNMLSVGIYNRLVIHTPNRLSGGQETEDTAEPPDEPIN 198

  Fly   185 LHLKPNPKGSKGGKCC 200
            |..|...:......||
  Fly   199 LAGKDRQRAKDSNTCC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 86/211 (41%)
Rab9FbNP_727472.1 RAB 8..171 CDD:197555 74/162 (46%)
Rab 8..165 CDD:206640 72/156 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454357
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.