DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and Rab27

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster


Alignment Length:219 Identity:67/219 - (30%)
Similarity:113/219 - (51%) Gaps:30/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTV--DIEGM--RVKLQIWDTAGQERF 70
            :.|::|||||||:.||.:::|..|...:|:|:|:||:.:.:  :..|.  |:.||||||||||||
  Fly    19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQERF 83

  Fly    71 RTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNC-----DVVKKVLVGNKNDDPDRKVV 130
            |::|:.:||...|.::::|:|:.:||.....||.:::.:.     ||   ||.|||.|....:||
  Fly    84 RSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDV---VLCGNKCDLLQLRVV 145

  Fly   131 ITEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDH---------------KLRTSPN-- 178
            ..:......::..:...||||....||:.....:..:|::.               :.|..||  
  Fly   146 SRDQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIENAACNREFSLLLTQSRCLPNIA 210

  Fly   179 -EQQKDTLHLKPNPKGSKGGKCCR 201
             .|.:|.:.|....:.....:.||
  Fly   211 YGQPEDLVRLHDRREEPCSRRNCR 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 65/217 (30%)
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 59/170 (35%)
RAB 20..186 CDD:197555 59/168 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454554
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.