DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and Ift27

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001123967.1 Gene:Ift27 / 300062 RGDID:1308703 Length:186 Species:Rattus norvegicus


Alignment Length:164 Identity:59/164 - (35%)
Similarity:92/164 - (56%) Gaps:6/164 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KLLIIGDSGVGKSSLLIRF-SDDT-FSGSYITTIGVDFKIRTVDI--EGMRVKLQIWDTAGQERF 70
            |.::.||..|||::|:..| ||.| |..:|..|.|||..::||.:  ....|:|.|:|:||:|.|
  Rat     7 KCILAGDPAVGKTALVQMFRSDGTHFQKNYTLTTGVDLVVKTVPVLDTNDSVELFIFDSAGKELF 71

  Fly    71 RTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVK--KVLVGNKNDDPDRKVVITE 133
            ..:....:...:.:.:||||||.:||.:..:|||::::....:.  .||||.|.|...|:.|.:.
  Rat    72 SEMLDKLWENPNVLCLVYDVTNEQSFISCTKWLEKVRSQTPGISLPGVLVGTKTDLAGRQTVDSA 136

  Fly   134 DAQRFAKQMDIELFETSAKDNINVENMFLSITRQ 167
            .||.:|....:|.||||.|:..|.|..|..:.:|
  Rat   137 QAQAWALSQGLEFFETSVKEMDNYEAPFHCLAKQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 59/164 (36%)
Ift27NP_001123967.1 P-loop_NTPase 6..172 CDD:304359 59/164 (36%)
Ras 7..173 CDD:278499 59/164 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0079
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.