DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and ypt2

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_594580.1 Gene:ypt2 / 2543280 PomBaseID:SPAC9E9.07c Length:200 Species:Schizosaccharomyces pombe


Alignment Length:201 Identity:98/201 - (48%)
Similarity:143/201 - (71%) Gaps:7/201 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQ 67
            :.:|:|.|||:|||||||||.||:|||:|:|:.|:|||||:||||||::::|.|:||||||||||
pombe     4 KSYDYLIKLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQ 68

  Fly    68 ERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEI-QNNCDVVKKVLVGNKNDDPDRKVVI 131
            |||||||:.||||..|::::||||:.:||.|||.|...: |:..:.|.|:|:|||.|..|::.|.
pombe    69 ERFRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHASENVYKILIGNKCDCEDQRQVS 133

  Fly   132 TEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNE--QQKDTLHLKPNPKGS 194
            .|..|..|.::.::..|.|||.|:||:..|.::.|::...|: .:.||  .|.:.:.| .|.:..
pombe   134 FEQGQALADELGVKFLEASAKTNVNVDEAFFTLAREIKKQKI-DAENEFSNQANNVDL-GNDRTV 196

  Fly   195 KGGKCC 200
            |  :||
pombe   197 K--RCC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 98/201 (49%)
ypt2NP_594580.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 89/165 (54%)
Ras 11..172 CDD:278499 87/160 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.