DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and RASEF

DIOPT Version :10

Sequence 1:NP_608373.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_689786.2 Gene:RASEF / 158158 HGNCID:26464 Length:740 Species:Homo sapiens


Alignment Length:200 Identity:77/200 - (38%)
Similarity:116/200 - (57%) Gaps:11/200 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQERFRTI 73
            :|:::.||:.|||||.|:|...:.|..:...|:||||:::|:.::|.|..||:||||||||||:|
Human   542 YKIVLAGDAAVGKSSFLMRLCKNEFRENISATLGVDFQMKTLIVDGERTVLQLWDTAGQERFRSI 606

  Fly    74 TSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNC-DVVKKVLVGNKNDDPD------RKVVI 131
            ..:|:|...||:::||||..:||.|:|.|::.|::.. :.|..:|||||.|..|      :|.|.
Human   607 AKSYFRKADGVLLLYDVTCEKSFLNIREWVDMIEDAAHETVPIMLVGNKADIRDTAATEGQKCVP 671

  Fly   132 TEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTLHLKPNPKGSKG 196
            ....::.|........||||||..|:....|.:.|:|   |.||..::.:..|.....|.|.|..
Human   672 GHFGEKLAMTYGALFCETSAKDGSNIVEAVLHLAREV---KKRTDKDDSRSITNLTGTNSKKSPQ 733

  Fly   197 GK-CC 200
            .| ||
Human   734 MKNCC 738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_608373.1 Rab35 3..201 CDD:133310 76/199 (38%)
RASEFNP_689786.2 FRQ1 <1..71 CDD:444056
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..110
SMC_prok_B <174..>351 CDD:274008
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 376..403
Rab 542..706 CDD:206640 65/163 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 713..740 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.