DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and Rab37

DIOPT Version :10

Sequence 1:NP_608373.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001417255.1 Gene:Rab37 / 100364984 RGDID:2319982 Length:253 Species:Rattus norvegicus


Alignment Length:198 Identity:85/198 - (42%)
Similarity:126/198 - (63%) Gaps:13/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FKLLIIGDSGVGKSSLLIRFSDDTF-SGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQERFRT 72
            |.::::|||||||:..||:|.|..| ||::|.|:|:||:.:.|.::|.||||||||||||||||:
  Rat    60 FTVMLLGDSGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNKVVTVDGARVKLQIWDTAGQERFRS 124

  Fly    73 ITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNC--DVVKKVLVGNKNDDPDRKVVITEDA 135
            :|..|||....::::||:||..||.|:|.||.||....  ||| .:|:|||.|....:|:.:||.
  Rat   125 VTHAYYRDAQALLLLYDITNQSSFDNIRAWLTEIHEYAQRDVV-IMLLGNKADVSSERVIRSEDG 188

  Fly   136 QRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNE---QQKDTLHLKPNPKGSKGG 197
            :..|::..:...|||||..:|||..||:|.:: |.::....|:|   |.:|.:..:     .|..
  Rat   189 ETLAREYGVPFMETSAKTGMNVELAFLAIAKE-LKYRAGKQPDEPSFQIRDYVESQ-----KKRS 247

  Fly   198 KCC 200
            .||
  Rat   248 SCC 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_608373.1 Rab35 3..201 CDD:133310 85/198 (43%)
Rab37NP_001417255.1 None

Return to query results.
Submit another query.