DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and Rab1b

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001103449.1 Gene:Rab1b / 100126191 RGDID:1642882 Length:201 Species:Rattus norvegicus


Alignment Length:200 Identity:108/200 - (54%)
Similarity:144/200 - (72%) Gaps:7/200 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQER 69
            :|:|||||:|||||||||.||:||:|||::.|||:||||||||||::::|..:||||||||||||
  Rat     5 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQER 69

  Fly    70 FRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNC-DVVKKVLVGNKNDDPDRKVVITE 133
            ||||||:||||.||:|||||||:.||:|||::||:||.... :.|.|:|||||:|...:|||...
  Rat    70 FRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNT 134

  Fly   134 DAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNEQ---QKDTLHLKPNPKGSK 195
            .|:.||..:.:...|||||:..|||..|:::..::   |.|..|...   ::..|.:...|..|.
  Rat   135 TAKEFADSLGVPFLETSAKNATNVEQAFMTMAAEI---KKRMGPGAASGGERPNLKIDSTPVKSA 196

  Fly   196 GGKCC 200
            .|.||
  Rat   197 SGGCC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 107/199 (54%)
Rab1bNP_001103449.1 Rab1_Ypt1 7..172 CDD:206661 99/167 (59%)
Effector region. /evidence=ECO:0000255 37..45 6/7 (86%)
Switch 2 region, required for interaction with REP1/CHM. /evidence=ECO:0000250|UniProtKB:Q9H0U4 64..83 16/18 (89%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..201 5/27 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.