DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab35 and rab3b

DIOPT Version :9

Sequence 1:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001093746.1 Gene:rab3b / 100101786 XenbaseID:XB-GENE-483427 Length:217 Species:Xenopus tropicalis


Alignment Length:194 Identity:86/194 - (44%)
Similarity:127/194 - (65%) Gaps:11/194 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQ 67
            :.||::|||||||:|.|||:|.|.|::||||:.::::|:|:|||::||.....||||||||||||
 Frog    17 QNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTSAFVSTVGIDFKVKTVYRNDKRVKLQIWDTAGQ 81

  Fly    68 ERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQN-NCDVVKKVLVGNKNDDPDRKVVI 131
            ||:||||:.||||..|.|::||:|:..|:..|:.|..:|:. :.|..:.:|||||.|..:.:|:.
 Frog    82 ERYRTITTAYYRGAMGFILMYDITSESSYNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVIA 146

  Fly   132 TEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTLHLKPNPKGSK 195
            .|..:..|.|:..|.||.|||:||.|:.:|..:...:.| |:..|.:..|         |.|.|
 Frog   147 PEKGKHLADQLGFEFFEASAKENIQVKQVFERLVDIICD-KMSESLDTDQ---------PPGGK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 86/194 (44%)
rab3bNP_001093746.1 Rab3 22..186 CDD:206657 78/164 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.