DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and FHL1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_015429.1 Gene:FHL1 / 856219 SGDID:S000006308 Length:936 Species:Saccharomyces cerevisiae


Alignment Length:201 Identity:51/201 - (25%)
Similarity:79/201 - (39%) Gaps:42/201 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DTTPIFQSSFSIRSLLSVDKKEESPISKH--NSGSSFSSCSSSSSNSSS-------------DSM 51
            :...|.:|..:.|:|     |:..|.||.  .:|:......:..:....             :.:
Yeast   395 ENADIAESEINTRNL-----KKNEPKSKKKITTGAKPKKAQTKPAVKKEKKPPKIPKKVYTLEEI 454

  Fly    52 AAKSNAKPAFTYSALIVMAIWS-SSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPF 115
            ..:...||..:|||::...|.. |:.|.::||.|...|.:.||||:.....||:|:|||||||..
Yeast   455 PVEYRTKPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKS 519

  Fly   116 FVRVPRALDDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTG---------HPYQ 171
            |    |.:...|:|..|.||.        |......|...:|:..|..|...         |..|
Yeast   520 F----RKVSKEGKGWLWGLDE--------EYIAERERQKKKQSEIAVAKAQAAQLKLEQQQHKLQ 572

  Fly   172 RMPYYG 177
            ::|..|
Yeast   573 QVPQRG 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 31/77 (40%)
FHL1NP_015429.1 COG5025 18..739 CDD:227358 51/201 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.