DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and FKH2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_014331.3 Gene:FKH2 / 855656 SGDID:S000005012 Length:862 Species:Saccharomyces cerevisiae


Alignment Length:237 Identity:68/237 - (28%)
Similarity:108/237 - (45%) Gaps:46/237 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ISKHNSGSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADN 91
            :..:.|.:::......:|:.|.|.   ..|.||..:|:.:|..||.||.|..::|:.|.|:|:.|
Yeast   312 VDSYKSSNAYPQALDFTSDLSHDE---NRNVKPPHSYATMITQAILSSPEGVISLADIYKYISSN 373

  Fly    92 FPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWAL-DPYAEDLSIGETTGRLRRSNW 155
            :.|||..||.||||||||||||..|.:|||..::||:|..|.: :.|.::.          .:.|
Yeast   374 YAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISESYQQEF----------LNKW 428

  Fly   156 QQNTGARPKVTGHPYQRMPYYGHGHGNGPYIKAHSAYF---PI-MDHQHHAAMVQHYQAMMHRYQ 216
              |||...|:.           .|......::.|.|.|   |: ||::....|.|..:..:..:.
Yeast   429 --NTGKVGKIR-----------RGSSVARQLQLHMAKFNSLPMEMDYRLSLNMAQPPKRQLQSHN 480

  Fly   217 MMPHPHHH------QH---------QHQHQHPHSHFIQQSKP 243
            ::...:::      ||         ..|.|.|.||..|..:|
Yeast   481 VLEPSNNNIIEGFVQHVPSKGNLPASQQSQPPVSHQNQSQQP 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 39/77 (51%)
FKH2NP_014331.3 COG5025 1..610 CDD:227358 68/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I1615
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.