DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and FKH1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_012135.1 Gene:FKH1 / 854675 SGDID:S000001393 Length:484 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:47/151 - (31%)
Similarity:79/151 - (52%) Gaps:18/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLSVDKKEESPISKHNSGSSFSSCSSSSSNSS------------SD-SMAAKSNAKPAFTYSALI 67
            ::..|:::|:    :..|....:..:||||::            || |:......||..:|:::|
Yeast   252 MMEEDEEDEN----YTRGGIRPNTYTSSSNNAVTNGNVPHIENPSDLSLDENRYIKPPQSYASMI 312

  Fly    68 VMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYW 132
            ..||.|:.|..::|:.|.|:|:||:.:||..:..||||:|||||||..|.:||:.....|:|..|
Yeast   313 TQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNW 377

  Fly   133 AL-DPYAEDLSIGETTGRLRR 152
            .: |....|.......|:|.:
Yeast   378 KISDEVRRDFLNKWNAGKLSK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 33/77 (43%)
FKH1NP_012135.1 COG5025 1..484 CDD:227358 47/151 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I1615
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1751
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.