DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxj3

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001313317.1 Gene:foxj3 / 797147 ZFINID:ZDB-GENE-101005-1 Length:596 Species:Danio rerio


Alignment Length:370 Identity:97/370 - (26%)
Similarity:132/370 - (35%) Gaps:160/370 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSV 101
            |:....::....:.:....:.||.::|::||..||.||.:|::|||.|.:||.|||||||...|.
Zfish    41 SALLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSG 105

  Fly   102 WQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALD------------------------PYAED-- 140
            |:||||||||||..|::|||:.||||:|.|||:|                        ||:.:  
Zfish   106 WKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDTLPTRPKKRPRSGERASTPYSLESD 170

  Fly   141 ---------------LSIGETTGRLRRSNWQQNTGARPK-------------------------- 164
                           |:|...|.::...|..|:....|:                          
Zfish   171 NLGMDCIISGSASPTLAINTVTNKVALYNPDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSY 235

  Fly   165 --VTGHP---YQRMPYYGHGHGNGPYIKAHSAYFPIMDHQ------------------HHAAMVQ 206
              ||.||   .|.|...          :|..|.:.|.|..                  :.....|
Zfish   236 TPVTSHPESVSQSMSLQ----------QAPQAQYSIPDRDKQLLFSEFEDLSASFRSLYKTVFEQ 290

  Fly   207 HY--QAMM----------H---RYQMMP--HPH-------------------------------- 222
            .|  |::|          |   .||..|  |||                                
Zfish   291 SYNQQSLMGLPSESSQQTHTSCSYQHSPSSHPHNNQNSITNSHPNNIPNNGSQVPLSHPPHSAHN 355

  Fly   223 --HHQHQHQH----QHPHSHFIQQSKPLHIQEPYH--HTRYHLHQ 259
              |.||..||    ||||:...|.  |.|.|.|.|  |:: |.||
Zfish   356 SPHGQHLSQHGPHSQHPHTAHSQH--PQHSQHPQHSQHSQ-HGHQ 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 47/76 (62%)
foxj3NP_001313317.1 Forkhead 62..139 CDD:278670 47/76 (62%)
SelP_N <327..394 CDD:282453 16/69 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.