DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxc1b

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_571804.1 Gene:foxc1b / 79375 ZFINID:ZDB-GENE-010302-2 Length:433 Species:Danio rerio


Alignment Length:130 Identity:55/130 - (42%)
Similarity:79/130 - (60%) Gaps:4/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SPIS--KHNSGSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKW 87
            :|:|  .|.:...:....:.:....:.:...|...||.::|.|||.|||.:||:|::||:||.::
Zfish    39 APMSMYSHATHEQYPGGMARAYGPYAPAQQPKDMVKPPYSYIALITMAIQNSSDKKITLNGIYQF 103

  Fly    88 IADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDLSIGETTGRLRR 152
            |.:.||:||..|..||||||||||||..||:|||....||:|.||.|||  :..::.|....|||
Zfish   104 IMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDP--DSYNMFENGSFLRR 166

  Fly   153  152
            Zfish   167  166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 44/76 (58%)
foxc1bNP_571804.1 Forkhead 74..160 CDD:278670 47/87 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..250
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.