DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxf1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001039226.1 Gene:foxf1 / 734087 XenbaseID:XB-GENE-478922 Length:373 Species:Xenopus tropicalis


Alignment Length:163 Identity:59/163 - (36%)
Similarity:89/163 - (54%) Gaps:11/163 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EESPIS----KHNSGSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSG 83
            :.||:|    ||....|....::.::.:...:...:...||.::|.|||||||.||..||||||.
 Frog    15 QSSPMSAATDKHGGQPSVMESANCATKTKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSE 79

  Fly    84 ICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDLSIGETTG 148
            |.:::...||::|.....|:||:|||||||..|:::|:.|..||:||||.:|| |.:....|.:.
 Frog    80 IYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDP-ASEFMFEEGSF 143

  Fly   149 RLRRSNWQQNTGA-RPKVTGHPYQRMPYYGHGH 180
            |.|...:::...| :|.     |..|...|..|
 Frog   144 RRRPRGFRRKCQALKPM-----YSMMNGLGFNH 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
foxf1NP_001039226.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 6/35 (17%)
Forkhead 53..139 CDD:365978 44/86 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..255
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.