Sequence 1: | NP_608369.1 | Gene: | fd19B / 33010 | FlyBaseID: | FBgn0031086 | Length: | 260 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002934447.2 | Gene: | foxq1 / 733448 | XenbaseID: | XB-GENE-483842 | Length: | 437 | Species: | Xenopus tropicalis |
Alignment Length: | 331 | Identity: | 76/331 - (22%) |
---|---|---|---|
Similarity: | 114/331 - (34%) | Gaps: | 124/331 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 KEESPISKHNSGSSFSSCSSSSSN--SSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGI 84
Fly 85 CKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDP----GRGHYWALDPYAE------ 139
Fly 140 -------------------DL----------------------------------SIGETTGRLR 151
Fly 152 RSNWQQNTGAR-------PKVTGHPYQRM-----PYYG------------HGHGNGP-------- 184
Fly 185 ---YIKAHSAYFPIMDHQHHAAMVQHYQAMMHRY----------------QMMPHPHHHQHQHQ- 229
Fly 230 -HQHPH 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd19B | NP_608369.1 | FH | 58..135 | CDD:238016 | 37/80 (46%) |
foxq1 | XP_002934447.2 | FH_FOXQ1-like | 111..189 | CDD:410808 | 37/80 (46%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |