DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxq1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_002934447.2 Gene:foxq1 / 733448 XenbaseID:XB-GENE-483842 Length:437 Species:Xenopus tropicalis


Alignment Length:331 Identity:76/331 - (22%)
Similarity:114/331 - (34%) Gaps:124/331 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KEESPISKHNSGSSFSSCSSSSSN--SSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGI 84
            :||..::...:|.|....:...:.  ....:.......||.::|.|||.|||..|:..||||:.|
 Frog    73 EEEEEVNPERNGVSADGSTQCRAQIVEGGKTKTYTRRPKPPYSYIALIAMAIKDSASGRLTLAEI 137

  Fly    85 CKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDP----GRGHYWALDPYAE------ 139
            ..::...||::|...:.|:||:|||||||..||:|   |.||    |:.:||.|:|.:|      
 Frog   138 NDYLMKKFPFFRGSYTGWRNSVRHNLSLNDCFVKV---LRDPSRPWGKDNYWMLNPNSEYTFADG 199

  Fly   140 -------------------DL----------------------------------SIGETTGRLR 151
                               ||                                  |...|.....
 Frog   200 VFRRRRKRLNRVTKCLKEQDLQGLAEQQHQMMNPTKASQGSSPSSSRLIMAPSAPSSSSTNSSSN 264

  Fly   152 RSNWQQNTGAR-------PKVTGHPYQRM-----PYYG------------HGHGNGP-------- 184
            ||..:.|:|.:       ..:...|:||.     |...            |...:.|        
 Frog   265 RSAKETNSGTKFSSSFAIESILSKPFQRREREPDPRSSSGRILWPTGALLHSPSSAPSYPIVSYT 329

  Fly   185 ---YIKAHSAYFPIMDHQHHAAMVQHYQAMMHRY----------------QMMPHPHHHQHQHQ- 229
               .:.|.||.:||.....:|:.: |.|  ::||                .:.|.|...|..|: 
 Frog   330 PSTTLPAPSALYPISPLASNASSL-HLQ--LYRYCMPEALLLLMDPRSEGHLSPDPRDDQLSHRV 391

  Fly   230 -HQHPH 234
             .||||
 Frog   392 PPQHPH 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 37/80 (46%)
foxq1XP_002934447.2 FH_FOXQ1-like 111..189 CDD:410808 37/80 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.