DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxl2a

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001038717.1 Gene:foxl2a / 692279 ZFINID:ZDB-GENE-060512-241 Length:306 Species:Danio rerio


Alignment Length:291 Identity:94/291 - (32%)
Similarity:119/291 - (40%) Gaps:86/291 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDTTPIFQSSFSIRSLLSVDK---KEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSNAKPAFT 62
            ||||    ||       |.:|   |:|:|..|              ....||     ...||.::
Zfish    16 MDTT----SS-------SAEKDRTKDEAPPEK--------------GPDKSD-----PTQKPPYS 50

  Fly    63 YSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPG 127
            |.|||.|||..|||||||||||.::|...||:|...|..||||||||||||..|::|||......
Zfish    51 YVALIAMAIRESSEKRLTLSGIYQYIISKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGER 115

  Fly   128 RGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHPYQRMPYYGHGHG----------- 181
            :|:||.|||..||:.   ..|..||.. :.....||..|.....:..:.|.|:|           
Zfish   116 KGNYWTLDPACEDMF---EKGNYRRRR-RMKRPFRPPPTHFQPGKSLFGGEGYGYLSPPKYLQSG 176

  Fly   182 --------------------------NGPYIKAHSAYFPIMDHQHHAAMVQH--YQAMMHRYQMM 218
                                      |...:.|.|:|.|.       :.||.  ..:|::.|..:
Zfish   177 FINNSWSPAPMSYTSCQVSSGSVSPVNMKGLSAPSSYNPY-------SRVQSIGLPSMVNSYNGI 234

  Fly   219 PHPHHHQHQHQHQHPHSHFIQQSKPLHIQEP 249
            .|.|||.|.|.|..||:   ||..|.....|
Zfish   235 SHHHHHHHTHPHALPHA---QQLSPATAAAP 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 44/76 (58%)
foxl2aNP_001038717.1 Forkhead 46..131 CDD:306709 49/87 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.