DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxk2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_011247520.1 Gene:Foxk2 / 68837 MGIID:1916087 Length:690 Species:Mus musculus


Alignment Length:196 Identity:68/196 - (34%)
Similarity:99/196 - (50%) Gaps:35/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SVDKKEESPISKHNSGSSF--------SSCSSSSSNS-------SSDSMAAKSNAKPAFTYSALI 67
            ::......|.|...:|||.        |..|..:.||       :|...:.|.::||.::|:.||
Mouse   233 TISAANSCPSSPRGAGSSGYKVGRVMPSDLSLMADNSQPENEKEASGGDSPKDDSKPPYSYAQLI 297

  Fly    68 VMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYW 132
            |.||..:.:|:|||:||...|..|:|||||....||||||||||||.:|::|||:.::||:|.:|
Mouse   298 VQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFW 362

  Fly   133 ALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHPYQRMPYYGHGHGNGP-------YIKAHS 190
            .:|| |.:..:.|...|.|          ||:  |.|..|.|.......:.|       .:.|||
Mouse   363 RIDP-ASESKLVEQAFRKR----------RPR--GVPCFRTPLGPLSSRSAPASPNHAGVLSAHS 414

  Fly   191 A 191
            :
Mouse   415 S 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
Foxk2XP_011247520.1 FHA 41..>124 CDD:238017
COG5025 <175..>381 CDD:227358 58/158 (37%)
Forkhead 287..373 CDD:365978 44/86 (51%)
PHA03247 <380..683 CDD:223021 11/48 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.