Sequence 1: | NP_608369.1 | Gene: | fd19B / 33010 | FlyBaseID: | FBgn0031086 | Length: | 260 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011247520.1 | Gene: | Foxk2 / 68837 | MGIID: | 1916087 | Length: | 690 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 68/196 - (34%) |
---|---|---|---|
Similarity: | 99/196 - (50%) | Gaps: | 35/196 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 SVDKKEESPISKHNSGSSF--------SSCSSSSSNS-------SSDSMAAKSNAKPAFTYSALI 67
Fly 68 VMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYW 132
Fly 133 ALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHPYQRMPYYGHGHGNGP-------YIKAHS 190
Fly 191 A 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd19B | NP_608369.1 | FH | 58..135 | CDD:238016 | 41/76 (54%) |
Foxk2 | XP_011247520.1 | FHA | 41..>124 | CDD:238017 | |
COG5025 | <175..>381 | CDD:227358 | 58/158 (37%) | ||
Forkhead | 287..373 | CDD:365978 | 44/86 (51%) | ||
PHA03247 | <380..683 | CDD:223021 | 11/48 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |