DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxf1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_006255786.2 Gene:Foxf1 / 687536 RGDID:1584229 Length:447 Species:Rattus norvegicus


Alignment Length:287 Identity:79/287 - (27%)
Similarity:122/287 - (42%) Gaps:81/287 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LSVDKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSNA------KPAFTYSALIVMAIWSSS 75
            :|...|::.|......|...:...:....::..:.|.|:||      ||.::|.|||||||.||.
  Rat    70 MSAPDKQQPPHGGGTGGGGGAGGQAMDPAAAGPTKAKKTNAGVRRPEKPPYSYIALIVMAIQSSP 134

  Fly    76 EKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAED 140
            .||||||.|.:::...||::|.....|:||:|||||||..|:::|:.|..||:||||.:|| |.:
  Rat   135 SKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDP-ASE 198

  Fly   141 LSIGETTGRLRRSNWQQNTGA-RP---KVTGHPYQRMP-YYG----------------------- 177
            ....|.:.|.|...:::...| :|   .|.|..:..:| .||                       
  Rat   199 FMFEEGSFRRRPRGFRRKCQALKPVYSMVNGLGFNHLPDTYGFQGSGGLSCAPNSLALEGGLGMM 263

  Fly   178 HGH--GN--GPYIKAHSAYFPIMDHQHHAAMVQHYQAMMHRYQMMPH-PHHHQHQHQ-------- 229
            :||  ||  |..:.:||                           :|| |.:..|.:.        
  Rat   264 NGHLTGNVDGMALPSHS---------------------------VPHLPSNGGHSYMGGCGGSAA 301

  Fly   230 HQHPHSHFIQQSKPL------HIQEPY 250
            .::||......:.||      .:.||:
  Rat   302 GEYPHHDSSVPASPLLPAGAGGVMEPH 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
Foxf1XP_006255786.2 FH_FOXF1 118..216 CDD:410823 46/98 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.