DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxl3

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_038945901.1 Gene:Foxl3 / 680273 RGDID:1594158 Length:216 Species:Rattus norvegicus


Alignment Length:134 Identity:56/134 - (41%)
Similarity:70/134 - (52%) Gaps:9/134 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NSSSDSMAA------KSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQ 103
            |..:|...|      |...:||::|.|||.|||..|...|:|||||..:|...|||||..:..||
  Rat    13 NDDADDYPAGSADEEKRLTRPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYRANQRAWQ 77

  Fly   104 NSIRHNLSLNPFFVRVPRAL-DDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTG 167
            ||||||||||..||:|||.. .|.|:|:||......|.|......|..||.  ::..|.:.:...
  Rat    78 NSIRHNLSLNSCFVKVPRTEGHDKGKGNYWTFAGGCESLLDLFENGNFRRR--RRRRGPKSEEAP 140

  Fly   168 HPYQ 171
            .|.|
  Rat   141 GPLQ 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 44/77 (57%)
Foxl3XP_038945901.1 Forkhead 32..115 CDD:395192 44/82 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.