DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxq1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_074049.2 Gene:Foxq1 / 64826 RGDID:621572 Length:400 Species:Rattus norvegicus


Alignment Length:184 Identity:60/184 - (32%)
Similarity:85/184 - (46%) Gaps:30/184 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SSFSSCSSS-SSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRT 97
            |....|:.| .....:.|.......||.::|.|||.|||..|:..||||:.|.:::...||::|.
  Rat    90 SPVGPCAGSVGGGEGARSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRG 154

  Fly    98 RKSVWQNSIRHNLSLNPFFVRVPRALDDP----GRGHYWALDPYAEDLSIGETTGRLRRSNWQQN 158
            ..:.|:||:|||||||..||:|   |.||    |:.:||.|:|.:| .:..:...|.||......
  Rat   155 SYTGWRNSVRHNLSLNDCFVKV---LRDPSRPWGKDNYWMLNPNSE-YTFADGVFRRRRKRLSHR 215

  Fly   159 T-----GARPK-----VTGHPYQRMPYYGHG----------HGNGPYIKAHSAY 192
            |     |.||:     ..|.| |..|..|..          .|:.|..|..|::
  Rat   216 TTVSASGLRPEEAPPGPAGTP-QPAPTAGSSPIARSPARQEEGSSPASKFSSSF 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 37/80 (46%)
Foxq1NP_074049.2 FH 115..193 CDD:238016 37/80 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.