DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxm1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_113821.2 Gene:Foxm1 / 58921 RGDID:61807 Length:771 Species:Rattus norvegicus


Alignment Length:111 Identity:43/111 - (38%)
Similarity:59/111 - (53%) Gaps:20/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYR-TRKSVW-- 102
            |.:|.|..||:    :.:|.::|.|:|..||.|:..||:||..|..||.|:|||:: ..|..|  
  Rat   222 SRASVSWQDSV----SERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKC 282

  Fly   103 ----------QNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYA 138
                      ||||||||||:..|||...|   .|:..:|.:.|.|
  Rat   283 WHQAYHKLGPQNSIRHNLSLHDMFVRETSA---NGKVSFWTIHPSA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 36/89 (40%)
Foxm1NP_113821.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..165
FH 235..322 CDD:238016 36/89 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..361
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..568
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 584..655
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 693..718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.