DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxe3

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001073150.2 Gene:foxe3 / 570855 ZFINID:ZDB-GENE-061214-6 Length:422 Species:Danio rerio


Alignment Length:163 Identity:68/163 - (41%)
Similarity:90/163 - (55%) Gaps:18/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRA 122
            ||.::|.|||.|||.:|.|::|||.||.|:|.:.||:||.....|||||||||:||..||::||.
Zfish   103 KPPYSYIALIAMAIANSPERKLTLGGIYKFIMERFPFYRENSKKWQNSIRHNLTLNDCFVKIPRE 167

  Fly   123 LDDPGRGHYWALDPYAEDL----SIGETTGRLRRSN------WQQNTGARPKVTGHPYQRMPYYG 177
            ...||:|:||.|||.|||:    |......|.:|::      :.|::.|   .|..|..|..|  
Zfish   168 PGRPGKGNYWTLDPAAEDMFDNGSFLRRRKRFKRTDVSTYPGYMQSSSA---FTPTPMGRQAY-- 227

  Fly   178 HGHGNGPYIKAHSAYFPIMDHQHHAAMVQHYQA 210
               .|..|....|.|...:....|.||:.||||
Zfish   228 ---PNTLYPGVTSGYGSQLAGSPHPAMLHHYQA 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 42/76 (55%)
foxe3NP_001073150.2 FH 103..191 CDD:214627 48/87 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.