DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxe1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_005159967.1 Gene:foxe1 / 567676 ZFINID:ZDB-GENE-061116-1 Length:354 Species:Danio rerio


Alignment Length:138 Identity:59/138 - (42%)
Similarity:81/138 - (58%) Gaps:18/138 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PISKHNSGSSFSSCSSSSSNSSSDSMAAK-----------SNAKPAFTYSALIVMAIWSSSEKRL 79
            |:.|..|.|     .|.::...:||..|:           ...||.::|.|||.|||.:|.:::|
Zfish     2 PVVKVESDS-----PSETTLPVNDSQRAEPQRGRRRKRPLQRGKPPYSYIALISMAIANSPDRKL 61

  Fly    80 TLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDLSIG 144
            ||.||.|:|.:.||:||.....|||||||||:||..|:::||....||:|:||||||.|||:.  
Zfish    62 TLGGIYKFITERFPFYRDNSKKWQNSIRHNLTLNDCFIKIPREPGRPGKGNYWALDPNAEDMF-- 124

  Fly   145 ETTGRLRR 152
            |:...|||
Zfish   125 ESGSFLRR 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
foxe1XP_005159967.1 FH 40..128 CDD:214627 48/89 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.