DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxf1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001073655.1 Gene:foxf1 / 566407 ZFINID:ZDB-GENE-050419-153 Length:380 Species:Danio rerio


Alignment Length:330 Identity:85/330 - (25%)
Similarity:130/330 - (39%) Gaps:98/330 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TPIFQSSFSIRSLLSVDKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSNA------KPAFT 62
            ||...|..:       :|..::|:.:             :|:|||.:.|.|:||      ||.::
Zfish    12 TPAHSSPMT-------EKPVQTPVME-------------TSSSSSSTKAKKTNAGIRRPEKPPYS 56

  Fly    63 YSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPG 127
            |.|||||||.||..||||||.|.:::...||::|.....|:||:|||||||..|:::|:.|..||
Zfish    57 YIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPG 121

  Fly   128 RGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGA-RPK----VTGHPYQRMP--YYGHGHGNGPY 185
            :||||.:|| |.:....|.:.|.|...:::...| :|.    :.|..:..:|  |...|.|.|..
Zfish   122 KGHYWTIDP-ASEFMFEEGSFRRRPRGFRRKCQALKPSMYSMMNGLGFNHIPESYNFQGGGGGLS 185

  Fly   186 IKAHSAYFPIMDHQHHAAMVQHYQAMMHRYQMMPH---------------------PHH------ 223
            ...:|..........:..:..:.:.|......|||                     |||      
Zfish   186 CPPNSLSLESGIGMMNGHLASNMEGMGLAGHSMPHLSTNSGHSYMGSCTGSSGTEYPHHDSSASP 250

  Fly   224 ------------------------------------HQHQHQHQHPHSHFIQQSKPLH-IQEPYH 251
                                                .|......:|.:..:|.|.|.| :::.|.
Zfish   251 LLTSGGVMDPHAVYSSTASAWPSAPPTSLNNGTSYIKQQPLSPCNPGASSLQPSLPTHSLEQSYL 315

  Fly   252 HTRYH 256
            |...|
Zfish   316 HQNGH 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
foxf1NP_001073655.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 13/56 (23%)
FH 52..140 CDD:214627 45/88 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.