DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and FOXJ2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_011519062.1 Gene:FOXJ2 / 55810 HGNCID:24818 Length:591 Species:Homo sapiens


Alignment Length:325 Identity:96/325 - (29%)
Similarity:132/325 - (40%) Gaps:99/325 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SLLSVDKKEE----SPISKHNSGS------SFSSCSSSS-----SNSSSDSMAAKSNAKPAFTYS 64
            ||.|:|...:    :.|.|..|.|      |...||..|     :..|.|..|...:.||.::|:
Human     8 SLTSIDWLPQLTLRATIEKLGSASQAGPPGSSRKCSPGSPTDPNATLSKDEAAVHQDGKPRYSYA 72

  Fly    65 ALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRG 129
            .||..||.||..|::|||.|.:||.||||||:.....|:||||||||||..|.:|||..||||:|
Human    73 TLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKG 137

  Fly   130 HYWALD-----------PYAEDLS------------------IGETT----GRLRRS-------- 153
            .||.:|           |..:|||                  .||.:    |..:.|        
Human   138 SYWTIDTCPDISRKRRHPPDDDLSQDSPEQEASKSPRGGVAGSGEASLPPEGNPQMSLQSPTSIA 202

  Fly   154 NWQQNTGA------------RPKVTGHPYQRMPYYGHGHG-NGPYIKAH---------SAYFPIM 196
            ::.|.||:            |....|.|    |.|...|. ...|.:.:         :.|..::
Human   203 SYSQGTGSVDGGAVAAGASGRESAEGPP----PLYNTNHDFKFSYSEINFQDLSWSFRNLYKSML 263

  Fly   197 DHQHHAAMVQH-YQAM-----------MHRYQMMPHPHHHQHQHQHQHPHSHFIQQSKPLHIQEP 249
            :....::  || :.::           |::.|..|.|   |.|.|.|.|.....|||:|...|.|
Human   264 EKSSSSS--QHGFSSLLGDIPPSNNYYMYQQQQPPPP---QQQQQQQQPPQPPPQQSQPQQQQAP 323

  Fly   250  249
            Human   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 44/76 (58%)
FOXJ2XP_011519062.1 Forkhead 66..143 CDD:278670 44/76 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4438
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.