DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and zgc:113424

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001038244.1 Gene:zgc:113424 / 554876 ZFINID:ZDB-GENE-050227-9 Length:300 Species:Danio rerio


Alignment Length:278 Identity:64/278 - (23%)
Similarity:98/278 - (35%) Gaps:87/278 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FSIRSLLSVDKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSS 75
            ||: .:||:|   :..|..:...:.|||..||.:.......||.       ||:.||..||..|.
Zfish    28 FSV-FILSLD---QGVIMTNGETAGFSSSQSSGAPRRMKQCAAG-------TYTGLIAYAIRESP 81

  Fly    76 EKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPG-RGHYWALD---- 135
            :|:||...|.|.:.   |:....|..::|:||..||....||:||...|.|. :.::|.:|    
Zfish    82 DKKLTFKQIMKKLE---PFVFGEKRNFENNIRVCLSAKKCFVKVPVDPDYPNPKKNFWKVDESCI 143

  Fly   136 -------------PYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHPYQRMPY------YGHGHG 181
                         |...|.||        ::.|......:|..   |.:.:|.      ......
Zfish   144 TPKLFQRHFKYIMPMFPDNSI--------QTQWVHKCEDKPSA---PEKLLPVCKVTENKSEVKF 197

  Fly   182 NGPY-----IKAHSAYFPIMDHQHHAAMVQHYQAMMHRYQMMPHPHHHQHQ-------HQHQ--- 231
            .||:     :|:                 .|....|...||..|||:.:.|       |.:.   
Zfish   198 TGPFSIESLLKS-----------------DHGVKRMRSTQMEEHPHYREAQCAATKRKHMYAAVE 245

  Fly   232 --HPHS----HFIQQSKP 243
              :|.|    |.:...:|
Zfish   246 CFYPVSAEGNHLVSTKRP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 26/77 (34%)
zgc:113424NP_001038244.1 FH 69..142 CDD:294049 26/75 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.