DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxi4.1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_012818282.1 Gene:foxi4.1 / 549541 XenbaseID:XB-GENE-5996107 Length:381 Species:Xenopus tropicalis


Alignment Length:186 Identity:76/186 - (40%)
Similarity:104/186 - (55%) Gaps:22/186 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SPISKH-NSGSSFSSCSSSS-----SNSSSD--------SMAAKSN----AKPAFTYSALIVMAI 71
            ||...| ||.:||...|..|     |||||.        |:|::..    .:|.::|||||.|||
 Frog    78 SPSYLHGNSPASFMPPSYRSQRQFLSNSSSFCGTDLSWLSVASQEELLKVVRPPYSYSALIAMAI 142

  Fly    72 WSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDP 136
            .::.||:||||.|.:::|||||:|:..|:.||||||||||||..|.:|||..||||:|:||.|||
 Frog   143 QNAPEKKLTLSQIYQYVADNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDP 207

  Fly   137 YAEDLSIGETTGRLRRSNWQQ-NTGARPKVTGHPYQRMPYYGHGHGNGPYIKAHSA 191
            ..|.:.   ..|..||...:: ::.:...||....:..|..|...|..|.:...|:
 Frog   208 NCEKMF---DNGNFRRKRKRRSDSSSAEAVTVKGEEGRPALGGKGGESPLMLTPSS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 46/76 (61%)
foxi4.1XP_012818282.1 Forkhead 129..214 CDD:365978 50/87 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.