DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxi3

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001102819.1 Gene:Foxi3 / 502846 RGDID:1561816 Length:400 Species:Rattus norvegicus


Alignment Length:145 Identity:65/145 - (44%)
Similarity:87/145 - (60%) Gaps:12/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SMAAKSN----AKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNL 110
            |||::.:    .:|.::|||||.|||.|:.|::||||.|.:::|||||:|:..|:.|||||||||
  Rat   119 SMASREDLMKMVRPPYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNL 183

  Fly   111 SLNPFFVRVPRALDDPGRGHYWALDPYAEDLSIGETTGRLRR------SNWQQNTGARPKVTGHP 169
            |||..|.:|||..||||:|:||.|||..|.:.......|.||      ||....:|. .|..|..
  Rat   184 SLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRRRRAEASSNLTVPSGT-SKSDGQS 247

  Fly   170 YQRMPYYGHGHGNGP 184
             .|:...|...|:.|
  Rat   248 -SRLRVSGKLEGDSP 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 46/76 (61%)
Foxi3NP_001102819.1 Forkhead 131..217 CDD:278670 50/85 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.