DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxd3

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001011383.1 Gene:foxd3 / 496851 XenbaseID:XB-GENE-487289 Length:369 Species:Xenopus tropicalis


Alignment Length:250 Identity:82/250 - (32%)
Similarity:117/250 - (46%) Gaps:52/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SSFSIRSLLSVDKKE-------ESPISKHN---------------SGSSFSSCSSSSSNSS---- 47
            |..|.:::||.|..:       :.|:.|.:               .|...:...|.|:|.:    
 Frog    10 SDMSGQTVLSADDADIDVVGEGDEPLDKDSECGSPAGHAEEADELGGKEIARSPSGSANEAEGKG 74

  Fly    48 ----SDSMAAK---SNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNS 105
                .:.|..|   |..||.::|.|||.|||..|.:|:|||||||::|::.|||||.:...||||
 Frog    75 ESQQQEGMQNKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNS 139

  Fly   106 IRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDL-SIGETTGRLRRSNWQQNTGARPKVTGHP 169
            ||||||||..||::||...:||:|:||.|||.:||: ..|....|.:|...||....|.:..   
 Frog   140 IRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRQQPDSLREQTA--- 201

  Fly   170 YQRMPYYGHGHGNGPYIKAHSAYFPIMDHQHHAAMVQHYQAMMHRY-----QMMP 219
             ..|..:|.....|||.:.:..         |.|...|..|:.:.|     .|:|
 Frog   202 -LMMQSFGAYSLAGPYGRPYGL---------HPAAYTHPAALQYPYIPPVGPMLP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 45/76 (59%)
foxd3NP_001011383.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 13/78 (17%)
Forkhead 92..177 CDD:365978 50/84 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.