DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxc1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001007864.1 Gene:foxc1 / 493250 XenbaseID:XB-GENE-479055 Length:495 Species:Xenopus tropicalis


Alignment Length:235 Identity:74/235 - (31%)
Similarity:98/235 - (41%) Gaps:68/235 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVR 118
            |...||.::|.|||.|||.::.||::||:||.::|.:.||:||..|..||||||||||||..||:
 Frog    75 KDMVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVK 139

  Fly   119 VPRALDDPGRGHYWALDPYAEDLSIGETTGRLRRSN-------------------WQQNTGARPK 164
            |||....||:|.||.|||  :..::.|....|||..                   .:::.|::|.
 Frog   140 VPRDDKKPGKGSYWTLDP--DSYNMFENGSFLRRRRRFKKKDVVKDATKEDKDRLLKEHHGSQPA 202

  Fly   165 VTGHPYQRMPYYGHGH-----GNGPYIKAHSAYFPIMDHQHHAAMVQHYQAMMHRYQMMP----- 219
            ..  ..||....|...     |:.|        ..|.|.:.........|||......:|     
 Frog   203 AA--QQQRQQQQGQAQAEQDSGSQP--------VRIQDIKTENGTSSPPQAMSPALSTVPKIESP 257

  Fly   220 ---------HPH---------------HHQHQHQHQHPHS 235
                     .||               ||.||   ||.||
 Frog   258 DSSSSMSSGSPHSIPSNRSMSLEAAESHHPHQ---QHHHS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 43/76 (57%)
foxc1NP_001007864.1 Forkhead 79..164 CDD:365978 46/86 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..322 23/133 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.