DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxj2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_031760837.1 Gene:foxj2 / 448174 XenbaseID:XB-GENE-483646 Length:522 Species:Xenopus tropicalis


Alignment Length:329 Identity:88/329 - (26%)
Similarity:122/329 - (37%) Gaps:110/329 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SLLSVDKKEESPISKHNSGSSFSSCSSSSSNS--------SSDSMAAKSNAKPAFTYSALIVMAI 71
            ||.|:|...:..|.....||..::.......|        |.:..||..:.||.::|:.||..||
 Frog    18 SLTSIDWLPQLTIQAAMKGSQQNNAGRKGPGSPTDPSAMLSKEEAAAHRDGKPPYSYANLIQYAI 82

  Fly    72 WSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALD- 135
            .|:..||:|||.|.:||.|||||||.....|:||||||||||..|.:|||..||||:|.||.:| 
 Frog    83 NSAPAKRMTLSEIYRWICDNFPYYRNAGVGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWMIDS 147

  Fly   136 -------------PYAEDLSIGETTGRLRRSNWQQNTGARP------------KVTGHPYQR--- 172
                         |:.:|        .:.:.:::|:....|            ...|||...   
 Frog   148 CPKEDVALPRRKRPHPDD--------EVSQDSFEQDVNKSPLRSASEVSMPQEGTQGHPMNNNSP 204

  Fly   173 MPYYGHG--------------HGNGPY-------------IKAHSAYFPIMDHQHHAAMVQHYQA 210
            :|.|...              :.|..|             ....|.|..::..|........|.:
 Frog   205 LPSYSQANPTQMPPDSRAPTYNNNDCYKFSFSESTFPDLGCSFRSLYHSLLGKQGERGDKDLYNS 269

  Fly   211 MMHRYQMMP-------------------------HPH-----------HHQHQHQHQHPHSHFIQ 239
            |..: |::|                         |||           |||.||| |.|:....|
 Frog   270 MQSK-QVLPPVHSEVQSSSCCMYQQNSGAAPSNLHPHNVPSISGPPPPHHQAQHQ-QPPYLPQQQ 332

  Fly   240 QSKP 243
            ..:|
 Frog   333 MPRP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 45/76 (59%)
foxj2XP_031760837.1 FH_FOXJ2 68..149 CDD:410825 46/80 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4323
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.