DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and fkh

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster


Alignment Length:272 Identity:80/272 - (29%)
Similarity:121/272 - (44%) Gaps:45/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PISKHNSGSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIAD 90
            |.|:.....|.:|...|..:..:....:.::|||.::|.:||.|||.::..:.||||.|.::|.|
  Fly   178 PGSREMETGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMD 242

  Fly    91 NFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDLSIGETTGRLRRSNW 155
            .||:||..:..|||||||:||.|..||::||..|.||:|.:|.|.|  :..::.|....|||   
  Fly   243 LFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHP--DSGNMFENGCYLRR--- 302

  Fly   156 QQNTGARPKVTGHPYQRMPYYGHGHGNGPYIKAHSAYFPIMDHQHHAAMVQHYQ----------- 209
            |:......|.......:.|.:.......|..|.|.....:  |.||.:.:.|:|           
  Fly   303 QKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDSHHM--HHHHHSRLDHHQHHKEAGGASIA 365

  Fly   210 ----------------AMMH---------RYQMMPHPHHHQ-HQHQHQHPHSHFIQQSKPLHIQE 248
                            ||:|         :.|.:|..|||| ||.|.:...:....:..|..|.:
  Fly   366 GVNVLSAAHSKDAEALAMLHANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITD 430

  Fly   249 PYHHTRYHLHQE 260
             ||.:.:.|.||
  Fly   431 -YHSSMHPLKQE 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 38/76 (50%)
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 5/30 (17%)
FH 210..298 CDD:214627 41/89 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445511
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.