DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and fd96Cb

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster


Alignment Length:176 Identity:57/176 - (32%)
Similarity:76/176 - (43%) Gaps:35/176 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRA 122
            ||.::|.:|..|||..|.::.|.||.|.::|.|.||:||.....||||:|||||.|..|::|||.
  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77

  Fly   123 LDDPGRGHYWALDPYAEDLSIGETTGRLRR-------------SNWQQNTGARPKVTGHPYQRMP 174
            :...|:|.||.|.|.|.|:.  |....|||             |||:....|..::..|      
  Fly    78 VTKAGKGSYWTLHPMAFDMF--ENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTH------ 134

  Fly   175 YYGHGHGNGPYIKAHSAYFPIMDHQHHAAMVQHYQAMMHRYQMMPH 220
                      |:..........|...|.    |..|.....||.|:
  Fly   135 ----------YLDDQLTQMAFADPARHG----HVLANASAAQMSPY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 36/76 (47%)
fd96CbNP_524496.1 FH 13..101 CDD:214627 41/89 (46%)
Alpha_kinase 106..>194 CDD:295997 13/81 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445524
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.