DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and jumu

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster


Alignment Length:164 Identity:49/164 - (29%)
Similarity:75/164 - (45%) Gaps:38/164 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QSSFSIRSLLSVDKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSN---------------- 56
            |:|.:.:|:.|.   ..||..:..|..|..|.||.||:|:|..:...||                
  Fly   331 QASTTPKSIASA---ANSPHHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSGL 392

  Fly    57 -----------------AKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQN 104
                             .|||::||.||.:|:.:|....|.:|.|..::..:|||:....|.|:|
  Fly   393 VKPLQQKVKLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKN 457

  Fly   105 SIRHNLSLNPFFVRV--PRALDDPGRGHYWALDP 136
            |:|||||||..|.::  |....:..:|..||::|
  Fly   458 SVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNP 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 31/78 (40%)
jumuNP_524302.1 Forkhead 411..499 CDD:278670 32/81 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445520
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.