DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and FoxP

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster


Alignment Length:157 Identity:47/157 - (29%)
Similarity:70/157 - (44%) Gaps:41/157 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RSLLSVDKKEESPISKHNSGS--------SFSSCSSSSSNSSSDSMA------------------ 52
            ||.|:|:.... ||.:.||.|        |.:.||....|...::.:                  
  Fly   250 RSPLTVNSIGR-PIRQTNSPSPLNLPMVNSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQ 313

  Fly    53 ---------AKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRH 108
                     ..::.:|.|||::||..||..|.:|:|||:.|..|..:.|.|:|...:.|:|:||.
  Fly   314 EIHRNREFYKNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRT 378

  Fly   109 NLSLNPFFVRVPRALDDPGRGHYWALD 135
            ||||:..|||..   ||  .|.:|.:|
  Fly   379 NLSLHKCFVRYE---DD--FGSFWMVD 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 33/76 (43%)
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777
FH 328..400 CDD:238016 33/76 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445492
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.