DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxg1b

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_998079.2 Gene:foxg1b / 405850 ZFINID:ZDB-GENE-040426-2437 Length:341 Species:Danio rerio


Alignment Length:231 Identity:92/231 - (39%)
Similarity:123/231 - (53%) Gaps:29/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SSFSIRSLL------SVDKKEE---SP-----ISKHNSGSSFSSCSSSSSNSSSDSMAAKSNAKP 59
            :||||:|||      |.|:..|   ||     :.|....:...:....:......:...|...||
Zfish    14 TSFSIKSLLLPSKFDSADESAERGGSPAPVQDLDKPPEDAEMDNAQRDAEEPELQTKKGKKFDKP 78

  Fly    60 AFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALD 124
            .|:|:|||:|||..|.||||||:||.::|..||||||..|..||||||||||||..||:|||..|
Zfish    79 PFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYREHKQGWQNSIRHNLSLNKCFVKVPRHYD 143

  Fly   125 DPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHPYQRMPYYGHGHGNGPYIKAH 189
            |||:|:||.|||.::|:.||.|||:|||    ::..:|.|:......|....|.|.|..|....:
Zfish   144 DPGKGNYWMLDPSSDDVFIGGTTGKLRR----RSATSRGKLVMKRGLRFAPLGLGLGERPSNPLY 204

  Fly   190 ---SAYFPIMDHQHHAAMVQHYQAMMHRYQMMPHPH 222
               |.:.|:    ||:    ||....|.:....|.:
Zfish   205 WQLSPFLPL----HHS----HYNGSAHGFLNQGHTY 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 51/76 (67%)
foxg1bNP_998079.2 FH 77..165 CDD:214627 57/87 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596116
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1751
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.