DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxd1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_998078.2 Gene:foxd1 / 405849 ZFINID:ZDB-GENE-040426-2094 Length:343 Species:Danio rerio


Alignment Length:179 Identity:69/179 - (38%)
Similarity:95/179 - (53%) Gaps:27/179 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 AAKSN-AKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPF 115
            |:|:. .||.::|.|||.|||..|.:||||||.||.:|::.|||||.:...||||||||||||..
Zfish    67 ASKNTLVKPPYSYIALITMAILQSPKKRLTLSEICDFISNRFPYYREKFPAWQNSIRHNLSLNDC 131

  Fly   116 FVRVPRALDDPGRGHYWALDPYAEDL-SIGETTGRLRRSNWQQ-------NTGARPKVTGHPYQR 172
            ||::||...:||:|:||.|||.:.|: ..|....|.:|...||       :.|..|....:.|..
Zfish   132 FVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQQAPELLREHGGFLPSAAAYGYGP 196

  Fly   173 MPYYGHGHGNGPYIKAHSAYFPIMDHQHHAAMVQHYQAMMHRYQMMPHP 221
               ||.|:|           ..:..:..|:|::    |...:.|..|.|
Zfish   197 ---YGCGYG-----------LQLQSYHAHSALL----AFQQQQQQQPPP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 45/76 (59%)
foxd1NP_998078.2 Forkhead 74..160 CDD:278670 49/85 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.