DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and FOXI2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_997309.2 Gene:FOXI2 / 399823 HGNCID:32448 Length:318 Species:Homo sapiens


Alignment Length:112 Identity:54/112 - (48%)
Similarity:73/112 - (65%) Gaps:10/112 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRA 122
            :|.::|||||.|||.|:..::||||.|.:::|.|||:|:..|:.||||||||||||..|.:|||.
Human   102 RPPYSYSALIAMAIQSAPLRKLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPRD 166

  Fly   123 LDDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQ-------NTGAR 162
            .||||:|:||.|||..|.:.   ..|..||...::       .:|||
Human   167 EDDPGKGNYWTLDPNCEKMF---DNGNFRRKRKRRAEASAAVRSGAR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 44/76 (58%)
FOXI2NP_997309.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Forkhead 102..188 CDD:278670 48/88 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.