DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxa2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_989423.1 Gene:foxa2 / 395063 XenbaseID:XB-GENE-480476 Length:434 Species:Xenopus tropicalis


Alignment Length:307 Identity:87/307 - (28%)
Similarity:129/307 - (42%) Gaps:72/307 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TPIFQSSFSIRSLLSVDKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAK---SNAKPAFTYSA 65
            :|:...:.|:.:|        :|.:..||.|..  ...|:.|.|.|....:   ::|||.::|.:
 Frog   102 SPMSAQATSMNAL--------APYTNMNSMSPI--YGQSNINRSRDPKTYRRSYTHAKPPYSYIS 156

  Fly    66 LIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGH 130
            ||.|||..|..|.||||.|.:||.|.||:||..:..|||||||:||.|..|::|||:.|.||:|.
 Frog   157 LITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGS 221

  Fly   131 YWALDPYA-----------------------------EDLSIGETT-GRLRRSNWQQNTG-ARPK 164
            :|.|.|.:                             :.||.|.:: |....|:.:.:.| ..|.
 Frog   222 FWTLHPDSGNMFENGCYLRRQKRFKCEKKPSLREGGGKKLSEGSSSVGSAANSSSESSVGNESPH 286

  Fly   165 VTGHPYQR----MPYYGHGHGNGPYIKAHSAYFPIMDHQHHAAMVQHYQAMMHRYQMMPHPHHH- 224
            .:..|.|.    :.......|..|   .|:| .|....||  .:.||:..:.|..|....|.|| 
 Frog   287 SSSSPCQEQKRSLVDMKSSQGLSP---DHAA-SPASQAQH--LLSQHHSVLSHEAQSHLKPEHHY 345

  Fly   225 ----------------QHQHQHQHPHSHFIQQSKPLHIQEPYHHTRY 255
                            ||.|.|.|.|.|..:.....: ::..|::.|
 Frog   346 SFNHPFSINNLMSSEQQHHHHHHHNHHHHHKMDLKAY-EQVMHYSGY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
foxa2NP_989423.1 Forkhead_N 17..148 CDD:369872 11/55 (20%)
FH 149..237 CDD:214627 43/87 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..339 20/95 (21%)
HNF_C 349..423 CDD:370449 9/44 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.