DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxa1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_989419.1 Gene:foxa1 / 395059 XenbaseID:XB-GENE-487352 Length:428 Species:Xenopus tropicalis


Alignment Length:273 Identity:81/273 - (29%)
Similarity:116/273 - (42%) Gaps:65/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NSGSSFSSCSSSSSNSSSDSMAAK---SNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNF 92
            |.|.|..:...|:.|.:.|:...:   .:|||.::|.:||.|||..:..|.||||.|.:||.|.|
 Frog   128 NPGMSPMAYGPSNMNRTRDTKTFRRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLF 192

  Fly    93 PYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDL-SIGETTGRLRRSNWQ 156
            .|||..:..|||||||:||.|..||:|.|:.|.||:|.||.|.|.:.:: ..|....|.:|...:
 Frog   193 LYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCE 257

  Fly   157 QNTG------ARPKVTG--HPYQRMPYYG----------------------HGHGNG---PYIKA 188
            :..|      .|..|:|  .|..|:  :|                      |...||   |.:.|
 Frog   258 KQQGGKGSQDGRKDVSGPSSPLHRV--HGKSSQMDSSSSMSNPSSSPQSLEHNGSNGEMKPQVAA 320

  Fly   189 HSAYFPIMDHQHHAAMVQHYQAMMHRYQMMPHPHHHQHQHQHQHPHSHFIQQSKPLHI------Q 247
            ..:  |:..||:|:.   |..|            |..|.|....||..|   :.|..|      .
 Frog   321 GPS--PLSSHQNHST---HSLA------------HETHIHLKGDPHYSF---NHPFSINNLMSSS 365

  Fly   248 EPYHHTRYHLHQE 260
            |..|...:..:::
 Frog   366 EQQHKLDFKAYEQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
foxa1NP_989419.1 Forkhead_N 17..157 CDD:369872 6/28 (21%)
FH 158..246 CDD:214627 43/87 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..337 17/86 (20%)
HNF_C 354..417 CDD:370449 4/25 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.