DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxi4.2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_989265.1 Gene:foxi4.2 / 394878 XenbaseID:XB-GENE-487658 Length:363 Species:Xenopus tropicalis


Alignment Length:197 Identity:67/197 - (34%)
Similarity:96/197 - (48%) Gaps:32/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PIFQSSFSIRSLLSVDKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVM 69
            |....||      ...:::..|.|....|:..|..|::|...      .....:|.::|||||.|
 Frog    84 PYMPPSF------GAPQRQFLPNSPAFGGTELSWMSAASQEE------LLKMVRPPYSYSALIAM 136

  Fly    70 AIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWAL 134
            ||..:|::|||||.|.:::|:|||:|:..|:.||||||||||||..|.:|||..:|||:|:||.|
 Frog   137 AIQHASDRRLTLSQIYQYVAENFPFYKKSKAGWQNSIRHNLSLNDCFKKVPRDENDPGKGNYWTL 201

  Fly   135 DPYAEDLSIGETTGRLRRSNWQQNTG----------------ARPKVT-GHPYQRMPYYGHGHGN 182
            ||..|.:.......|.|:.....|:.                :.|.:| ..|.:..|   .||..
 Frog   202 DPNCEKMFDNGNFRRKRKPKSDANSAKIAKIGEDHLNPKGKESPPMITPSSPEEPSP---TGHSK 263

  Fly   183 GP 184
            .|
 Frog   264 SP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 44/76 (58%)
foxi4.2NP_989265.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Forkhead 125..210 CDD:306709 48/84 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..269 10/59 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.