DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxm1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_957391.1 Gene:foxm1 / 394072 ZFINID:ZDB-GENE-040426-1275 Length:623 Species:Danio rerio


Alignment Length:116 Identity:40/116 - (34%)
Similarity:59/116 - (50%) Gaps:11/116 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NSGSSFSSCSSSSSNSSSDSMA---AKSN----AKPAFTYSALIVMAIWSSSEKRLTLSGICKWI 88
            :.|.....|.:..:.:.|...:   .|.|    .:|.::|.|:|..||.|.:.:.:||..|..||
Zfish   148 SDGLGSEKCPNKDNPNDSQQQSKGPEKENDPHSERPPYSYMAMIQFAINSKNNRHMTLKEIYNWI 212

  Fly    89 ADNFPYYR-TRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYA 138
            .|:|||:| ..|..|:|||||||||:..|:   |.....|:..||.:.|.|
Zfish   213 EDHFPYFRDIAKPGWKNSIRHNLSLHDMFI---RETSPDGKISYWTIRPEA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 33/77 (43%)
foxm1NP_957391.1 FH 182..256 CDD:238016 33/76 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.