DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxl1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_957278.1 Gene:foxl1 / 393959 ZFINID:ZDB-GENE-040426-1181 Length:363 Species:Danio rerio


Alignment Length:116 Identity:57/116 - (49%)
Similarity:71/116 - (61%) Gaps:2/116 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRA 122
            ||.::|.|||.|||.::.:||.|||||.::|.|.||||...|..||||||||||||..|::|||.
Zfish    52 KPPYSYIALIAMAIKNAPDKRATLSGIYQFIMDRFPYYHDNKQGWQNSIRHNLSLNDCFIKVPRE 116

  Fly   123 LDDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHPYQRM 173
            ...||:|.||.||....|:.......|.:|....|:|| ..|| ||...|:
Zfish   117 KGRPGKGSYWTLDTKCLDMFENGNYRRRKRKCRTQDTG-DTKV-GHKRTRV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 44/76 (58%)
foxl1NP_957278.1 FH 52..140 CDD:214627 47/87 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.