DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and FoxK

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster


Alignment Length:279 Identity:86/279 - (30%)
Similarity:127/279 - (45%) Gaps:64/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LSVDKKEE-SP-ISKHNSGSSFSSCSSS----------------SSNSSSDSMAAKS------NA 57
            :|:.|||: || :|...:.|:.:||.:|                .:|::.|.....|      |.
  Fly   388 ISIPKKEQKSPYLSPTGTISAANSCPASPRQGFIQNQPNNYNNYGNNNTQDLFQTPSTASYNHNE 452

  Fly    58 KPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYR--TRKSVWQNSIRHNLSLNPFFVRVP 120
            ||.::|:.|||.||.::.:|:||||||..:|..::||||  |.|. ||||||||||||.:|::|.
  Fly   453 KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKG-WQNSIRHNLSLNRYFIKVA 516

  Fly   121 RALDDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHPYQRMPYYGHGHGNGPY 185
            |:.|:||:|.:|.:||.:....|..:..:.|:.:.|   |.||     || .||      .:.|.
  Fly   517 RSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQ---GFRP-----PY-GMP------RSAPV 566

  Fly   186 IKAHSAYFPIMDHQHHAAMVQHYQAM-------MHRYQMMPHP---------HHHQHQHQHQHPH 234
            ..:|      ||:...::.:|.....       |...|....|         |..|.|.|.|...
  Fly   567 SPSH------MDNSRESSPLQDIVLQSAPGSPGMSLEQRAADPEIIYNSQNAHQQQQQQQQQQQQ 625

  Fly   235 SHFIQQSKPLHIQEPYHHT 253
            ......|.......||:.|
  Fly   626 QTLSNNSNQYSSGSPYYVT 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 42/78 (54%)
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 44/87 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445528
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.