DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and bin

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster


Alignment Length:371 Identity:88/371 - (23%)
Similarity:125/371 - (33%) Gaps:154/371 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SSFSIRSLLSVDKKEESPISKHN-----SGSSFSSCSSSSSNS--SSDSMAAKSNA----KPAFT 62
            ||.|.....|::..|.||.|:::     |||:......||...  |:.....||..    |||.:
  Fly   251 SSSSSSPAKSLNGSESSPPSQNHLENKVSGSAVVGTGGSSQQDAPSTPDTTKKSGTRRPEKPALS 315

  Fly    63 YSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRAL--DD 125
            |..:|..||..|...:||||.|..::..::.::|.....|:||:|||||||..|.::|:.:  ..
  Fly   316 YINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGK 380

  Fly   126 PGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHPY--QRMPYYGHGHG-----NG 183
            ||:|:||.:|..:..|.  |..|.|||    :..|.|.|:...||  ....||..|:|     ||
  Fly   381 PGKGNYWTIDENSAHLF--EDEGSLRR----RPRGYRSKIKVKPYAGHANGYYASGYGDAGMDNG 439

  Fly   184 PYI------------------------------KAHSAYF------------PIMDHQH------ 200
            .|.                              .||:|:.            |:..:.:      
  Fly   440 NYYASPAFASYDYSAAGATGVSPAGGQGFADPWNAHAAHSGSSSVGVGMGVGPLPQYTNISCLAA 504

  Fly   201 --------------HAAM----------------------------------------------- 204
                          |:|:                                               
  Fly   505 GGNVNGSATTPPLAHSALGMAPSASSSSSPLGAAATLQSDYAPTASLVAAGYSYATSAGSLDNGL 569

  Fly   205 -------------VQHYQAMMHRYQMMPHPHHHQHQHQHQHP-HSH 236
                         :||.||     |.....|||.|||...|| |||
  Fly   570 RSISLQQLPGLSSIQHAQA-----QAQAQAHHHHHQHHASHPSHSH 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 31/78 (40%)
binNP_523950.2 Forkhead 311..399 CDD:278670 33/89 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445456
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.