DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxi3b

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_944600.1 Gene:foxi3b / 387258 ZFINID:ZDB-GENE-031126-4 Length:383 Species:Danio rerio


Alignment Length:141 Identity:61/141 - (43%)
Similarity:81/141 - (57%) Gaps:10/141 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIR 107
            |..|..|.|..   .:|.::|||||.|||..:.|:|||||.|.:::|||||:|...|:.||||||
Zfish   118 SMPSQEDLMKL---VRPPYSYSALIAMAIHGAPERRLTLSQIYQYVADNFPFYNKSKAGWQNSIR 179

  Fly   108 HNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHPYQR 172
            ||||||..|.:|||..||||:|:||.|||..|.:.   ..|..||...:::.....|.:....:.
Zfish   180 HNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMF---DNGNFRRKRKRKSDSLPEKSSSGGNES 241

  Fly   173 MPYYGHGHGNG 183
                |..:|.|
Zfish   242 ----GDSNGRG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 46/76 (61%)
foxi3bNP_944600.1 FH 130..218 CDD:214627 50/90 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.