DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxl3

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001182057.1 Gene:Foxl3 / 384244 MGIID:3646467 Length:216 Species:Mus musculus


Alignment Length:179 Identity:66/179 - (36%)
Similarity:83/179 - (46%) Gaps:37/179 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NSSSDSMAAKSN------AKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQ 103
            |..:|...|.|:      .:||::|.|||.|||..|...|:|||||..:|...|||||..:..||
Mouse    13 NDDADDYPAGSSDEEKRLTRPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYRANQRAWQ 77

  Fly   104 NSIRHNLSLNPFFVRVPRAL-DDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGAR----- 162
            ||||||||||..||:|||.. :|.|:|:||......|.|......|..||.  ::..|.:     
Mouse    78 NSIRHNLSLNSCFVKVPRTEGNDKGKGNYWTFAGGCESLLDLFENGNFRRR--RRRRGPKREEAP 140

  Fly   163 ----PKVTGHPYQRMPYYGHGHGNGPYIKAHSAYFPIMDHQHHAAMVQH 207
                |...|.|             ||    .||..|  ||:..|:...|
Mouse   141 GPLEPTARGSP-------------GP----DSAQAP--DHEAQASPTTH 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 44/77 (57%)
Foxl3NP_001182057.1 Forkhead 32..118 CDD:278670 46/85 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.